PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g010890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 458aa    MW: 52293.6 Da    PI: 9.9677
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g010890.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B362.47.3e-2022103998
                     HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       +ks+ + +p kf+++h +  k+e+kt++l++    sW+ +   ++k ++++lt+GWkeFv+a+gL++gDf+vFk++g++ f  +v++f+
  Csa10g010890.1  22 PGFKSH-IKIPVKFFSKHiK-GKHEGKTVKLRS---DSWQGTW--KGKMEGHTLTNGWKEFVEAHGLRVGDFLVFKHEGDMLF--HVTAFE 103
                     567777.99*********64.456889***988...6666666..66668899***********************9999988..888876 PP

2B366.83.1e-21148242299
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     f++ +++++l+++ l +p++fa+++g++k ++ +++l++e+g+sWe +++  k++ ++++ +GWk+ + +n+ k+gD ++Fkl ++  ++lv+ +
  Csa10g010890.1 148 FSQSVTASNLSRDFLGVPRDFARRYGLDKGRH-EVVLMNEEGKSWESEVKSYKSG-QVFIFGGWKSLCTENKFKVGDPFTFKLLHN-AERLVFLL 239
                     6788999*********************9776.****************655555.555556********************9995.55579999 PP

                     E-S CS
              B3  97 frk 99 
                     +++
  Csa10g010890.1 240 CSR 242
                     987 PP

3B351.22.2e-16250347198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTE.EEE-.TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgr.yvlt.kGWkeFvkangLkegDfvvFkldgrsefel 92 
                     f+k + ++++lk+g   lp +f++e++++k++  +++l d++  +W +k +  rk+s++ yv++ +GWk+F+ an++ +g++++++l++  ++++
  Csa10g010890.1 250 FVKLTPTPNSLKLGKQHLPVSFMRENMLDKPG--KIILVDKDKVEWLMKRKGyRKGSRMmYVISgNGWKSFCAANEVGAGESLTLELIR-GGTSP 341
                     7888889999*****************99776..7**************96547777767555549*********************98.67777 PP

                     EEEEE- CS
              B3  93 vvkvfr 98 
                     ++k+++
  Csa10g010890.1 342 LLKFVS 347
                     887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.5E-259107IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.22E-2410111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.68913105IPR003340B3 DNA binding domain
CDDcd100171.23E-1714102No hitNo description
SMARTSM010194.9E-2216105IPR003340B3 DNA binding domain
PfamPF023627.3E-1525101IPR003340B3 DNA binding domain
SuperFamilySSF1019367.46E-21141241IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-20142241IPR015300DNA-binding pseudobarrel domain
CDDcd100172.11E-17147241No hitNo description
PROSITE profilePS5086314.804147242IPR003340B3 DNA binding domain
PfamPF023621.3E-20148242IPR003340B3 DNA binding domain
SMARTSM010192.3E-29148243IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.1E-15248346IPR015300DNA-binding pseudobarrel domain
CDDcd100173.48E-13249345No hitNo description
PfamPF023622.5E-15250347IPR003340B3 DNA binding domain
SMARTSM010192.6E-26250349IPR003340B3 DNA binding domain
SuperFamilySSF1019368.63E-16250351IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.196250349IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MENPSSSLFS PKNPHFFQPL LPGFKSHIKI PVKFFSKHIK GKHEGKTVKL RSDSWQGTWK  60
GKMEGHTLTN GWKEFVEAHG LRVGDFLVFK HEGDMLFHVT AFEPSCCEVQ YAQSLSHDEI  120
GESSRKEKEI EENVKTESDL FSSDLTCFSQ SVTASNLSRD FLGVPRDFAR RYGLDKGRHE  180
VVLMNEEGKS WESEVKSYKS GQVFIFGGWK SLCTENKFKV GDPFTFKLLH NAERLVFLLC  240
SRTEAGPNRF VKLTPTPNSL KLGKQHLPVS FMRENMLDKP GKIILVDKDK VEWLMKRKGY  300
RKGSRMMYVI SGNGWKSFCA ANEVGAGESL TLELIRGGTS PLLKFVSKME QSPSEAEARP  360
HKRARVQRWS QENRRLKHDV RQKITEEGEP SRRTRSSSKS TGDQENPQHT QSCSILDHLP  420
KVRQSIEETL TSIRRFRAKL ETKEQNLEAL LHEIGNY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432840.10.0PREDICTED: B3 domain-containing protein REM8-like isoform X2
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLD7MB410.0D7MB41_ARALL; Putative uncharacterized protein
STRINGAT4G31680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.10.0B3 family protein